Products

Online Inquiry

* First Name

* Last Name

Phone

* Business Email

Company/Institution

Job Title

* Services or Products of Interest

When do you expect your project to start?

Project Description

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Urocortin III, (mouse) TFA

Cat. No: CDIA-0896

Size: 5 mg

Price: Inquiry

Product Details
Formula	C188H313N52F3O54S2
Molecular Weight	4286.99
Appearance	Solid
Purity	99.56%
Sequence	Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2
Sequence Shortening	FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

Storage & Handling
Shipping	Room temperature.
Storage	Sealed storage, away from moisture *In solvent : -80 °C, 6 months; -20 °C, 1 month (sealed storage, away from moisture)
Storage Powder	-80 °C/2 years, -20 °C/1 year

Description

Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics.

! For research use only. Not intended for any clinical use.