Products

Online Inquiry

* First Name

* Last Name

Phone

* Business Email

Company/Institution

Job Title

* Services or Products of Interest

When do you expect your project to start?

Project Description

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Brain natriuretic peptide (1-32), (rat)

Cat. No: CDIA-1594

CAS. No.: 133448-20-1

Synonyms: BNP (1-32), rat

Size: 50 mg

Price: Inquiry

Product Details
Formula	C146H239N47O44S3
Molecular Weight	3452.94
Sequence	Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26)
Sequence Shortening	NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26)

Storage & Handling
Shipping	Room temperature.
Storage	Please refer to the instruction manual.

Description

Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

! For research use only. Not intended for any clinical use.