Gila Exendin (5-39) Protein

Gila Exendin (5-39) Protein

Cat. No.: DPP-001301

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Gila
Format Lyophilized
Purity ≥97% by SDS-PAGE
Target Information
Molecular Formula C169H262N44O54S
Molecular Weight 3806.5
Function This truncated Exendin-4 peptide, Exendin (5-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (5-39) antagonizes GLP-1–stimulated insulin release after food intake.
Sequence TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence H-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top