Cat. No.: DPP-001317
| Product Overview | |
|---|---|
| Species | Human |
| Format | Lyophilized |
| Purity | ≥ 90% by SDS-PAGE |
| Target Information | |
|---|---|
| Molecular Formula | C138H216N40O51S1 |
| Molecular Weight | 3283.53 |
| Function | Pancreastatin (24-52) or hPST29 peptide is one of the active short variants of the full-length peptide. It inhibits production of glycogen and regulates glucose-induced insulin secretion, lipid and protein metabolism in adipose tissue and liver. |
| Sequence | PEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2 |
| Sequence | Pro-Glu-Gly-Lys-Gly-Glu-Gln-Glu-His-Ser-Gln-Gln-Lys-Glu-Glu-Glu-Glu-Glu-Met-Ala-Val-Val-Pro-Gln-Gly-Leu-Phe-Arg-Gly-NH2 |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.