Human Preptin Protein

Human Preptin Protein

Cat. No.: DPP-001319

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Format Lyophilized
Purity ≥ 97% by SDS-PAGE
Target Information
Molecular Formula C187H275N47O53
Molecular Weight 4029.52
Function Preptin is a 34 amino acid peptide hormone that is produced from Asp(69)-Leu(102) of pro-IGF-II and is secreted by pancreatic β-cells. Preptin has been located in mammary tissue, the pancreas, and kidneys. High plasma concentrations of preptin was associated with obesity.
Sequence DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL-OH
Sequence Asp-Val-Ser-Thr-Pro-Pro-Thr-Val-Leu-Pro-Asp-Asn-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Gln-Tyr-Asp-Thr-Trp-Lys-Gln-Ser-Thr-Gln-Arg-Leu-OH
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top