Cat. No.: DPP-001326
| Product Overview | |
|---|---|
| Species | Porcine |
| Format | Lyophilized |
| Purity | ≥ 95% by SDS-PAGE |
| Target Information | |
|---|---|
| Molecular Formula | C192H295N59O60S1 |
| Molecular Weight | 4422.1 |
| Function | Following nutrient ingestion, both GLP-1, and Oxyntomodulin (OXM) are processed from proglucagon and secreted from the gut endocine L-cells. Oxyntomodulin (OXM), a 37-amino acid peptide hormone, causes weight loss in humans and rodents. It activates both the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR). It contains the same sequence as Glucagon (1-9), but with an additional KRNKNNIA C-terminal sequence. |
| Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| Sequence | H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.