Recombinant Human 5-HT2C Receptor Protein

Recombinant Human 5-HT2C Receptor Protein

Cat. No.: DPP-001117

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Wheat germ
Format Liquid
Purity ≥ 98% by HPLC
Nature Recombinant
Target Information
Gene Name HTR2C
UniProt No. P28335
Gene ID 3358
Molecular Weight 31 kDa including tags
Alternative Names 5 Hydroxytryptamine 2C receptor; 5-HT-1C; 5-ht-1c receptor; 5-HT-2C; 5-HT1C; 5-HT2C; 5-HTR2C; 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled; 5-hydroxytryptamine receptor 1C; 5-hydroxytryptamine receptor 2C; 5HT1C; 5HT2C; 5HT2C_HUMAN; 5HTR2C; 5Hydroxytryptamine 2C receptor; Htr1c; HTR2C; serotonin 1c receptor; serotonin 2c receptor; Serotonin 5-HT-2C receptor; Serotonin receptor 2C
Function This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Cellular Localization Cell membrane.
Protein Length Protein fragment
Sequence MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPD GV,Belongs to the G-protein coupled receptor 1 family.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top