Cat. No.: DPP-001265
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Escherichia coli |
| Format | Liquid |
| Purity | ≥97% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | AAMDC |
| UniProt No. | Q9H7C9 |
| Gene ID | 28971 |
| Molecular Weight | 16 kDa including tags |
| Alternative Names | AAMDC; adipogenesis associated, Mth938 domain containing; C11orf67; PTD015; RGD1561459 |
| Cellular Localization | Cytoplasm By similarity. Note: Diffuse distribution with some highly concentrated spots around the nucleus |
| Protein Length | Full length protein |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSMTSPEIASLSWGQMKVKGSNTTYKDCK VWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKV PSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.