Recombinant Human Adipose Triglyceride Lipase Protein (His tag)

Recombinant Human Adipose Triglyceride Lipase Protein (His tag)

Cat. No.: DPP-001256

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Escherichia coli
Format Liquid
Purity ≥97% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name PNPLA2
UniProt No. Q96AD5
Gene ID 57104
Molecular Weight 71 kDa including tags
Alternative Names 1110001C14Rik; Adipose triglyceride lipase; ATGL; ATGL DESNUTRIN; Calcium independent phospholipase A2; Calcium-independent phospholipase A2; Desnutrin; EC 3.1.1.3; FP17548; IPLA2 zeta; IPLA2-zeta; Mutant patatin like phospholipase domain containing 2; Patatin like phospholipase domain containing 2; PATATIN LIKE PHOSPHOLIPASE DOMAIN CONTAINING PROTEIN 2; Patatin-like phospholipase domain-containing protein 2; PEDF R; PHOSPHOLIPASE A2 CALCIUM INDEPENDENT ZETA; Pigment epithelium derived factor; Pigment epithelium-derived factor; plpl; plpl2; PLPL2_HUMAN; Pnpla2; Transport secretion protein 2; Transport secretion protein 2.2; Transport-secretion protein 2; Triglyceride hydrolase; TTS 2.2; TTS2; TTS2.2; ZETA
Function Catalyzes the initial step in triglyceride hydrolysis in adipocyte and non-adipocyte lipid droplets. Also has acylglycerol transacylase activity. May act coordinately with LIPE/HLS within the lipolytic cascade. Regulates adiposome size and may be involved in the degradation of adiposomes. May play an important role in energy homeostasis. May play a role in the response of the organism to starvation, enhancing hydrolysis of triglycerides and providing free fatty acids to other tissues to be oxidized in situations of energy depletion.
Involvement In Disease Genetic variations in PNPLA2 may be associated with risk of diabetes mellitus type 2.Defects in PNPLA2 are the cause of neutral lipid storage disease with myopathy (NLSDM); also known as neutral lipid storage disease without ichthyosis. NSLDM is a neutral lipid storage disorder (NLSD) with myopathy but without ichthyosis. NLSDs are characterized by the presence of triglyceride-containing cytoplasmic droplets in leukocytes and in other tissues, including bone marrow, skin, and muscle. Individuals with NLSDM did not show obesity, in spite of a defect in triglyceride degradation in fibroblasts and in marked triglyceride storage in liver, muscles, and other visceral cells.
Cellular Localization Lipid droplet. Cell membrane.
Protein Length Full length protein
Sequence MFPREKTWNISFAGCGFLGVYYVGVASCLREHAPFLVANATHIYGASAGA LTATALVTGVCLGEAGAKFIEVSKEARKRFLGPLHPSFNLVKIIRSFLLK VLPADSHEHASGRLGISLTRVSDGENVIISHFNSKDELIQANVCSGFIPV YCGLIPPSLQGVRYVDGGISDNLPLYELKNTITVSPFSGESDICPQDSST NIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQ RNGLLNRPNPLLALPPARPHGPEDKDQAVESAQAEDYSQLPGEDHILEHL PARLNEALLEACVEPTDLLTTLSNMLPVRLATAMMVPYTLPLESALSFTI RLLEWLPDVPEDIRWMKEQTGSICQYLVMRAKRKLGRHLPSRLPEQVELR RVQSLPSVPLSCAAYREALPGWMRNNLSLGDALAKWEECQRQLLLGLFCT NVAFPPEALRMRAPADPAPAPADPASPQHQLAGPAPLLSTPAPEARPVIG ALGL,Contains 1 patatin domain.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top