Recombinant Human Amylin/DAP Protein

Recombinant Human Amylin/DAP Protein

Cat. No.: DPP-001079

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Wheat germ
Format Liquid
Purity ≥ 70% by HPLC
Nature Recombinant
Target Information
Gene Name IAPP
UniProt No. P10997
Gene ID 3375
Molecular Weight 36 kDa including tags
Alternative Names Amylin; DAP; Diabetes associated peptide; Diabetes-associated peptide; IAP; IAPP; IAPP_HUMAN; Insulinoma amyloid peptide; Islet amyloid polypeptide; Islet amyloid polypeptide (diabetes associated peptide; amylin)
Function Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism.
Cellular Localization Secreted.
Protein Length Full length protein
Sequence MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV HSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL,Belongs to the calcitonin family.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top