Cat. No.: DPP-001079
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Wheat germ |
| Format | Liquid |
| Purity | ≥ 70% by HPLC |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | IAPP |
| UniProt No. | P10997 |
| Gene ID | 3375 |
| Molecular Weight | 36 kDa including tags |
| Alternative Names | Amylin; DAP; Diabetes associated peptide; Diabetes-associated peptide; IAP; IAPP; IAPP_HUMAN; Insulinoma amyloid peptide; Islet amyloid polypeptide; Islet amyloid polypeptide (diabetes associated peptide; amylin) |
| Function | Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism. |
| Cellular Localization | Secreted. |
| Protein Length | Full length protein |
| Sequence | MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV HSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL,Belongs to the calcitonin family. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.