Recombinant Human CCL28/MEC Protein

Recombinant Human CCL28/MEC Protein

Cat. No.: DPP-001274

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Escherichia coli
Endotoxin Level < 1.000 Eu/µg
Format Lyophilized
Purity ≥97% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name CCL28
UniProt No. Q9NRJ3
Gene ID 56477
Molecular Weight 12 kDa
Alternative Names C C motif chemokine ligand 28; C-C motif chemokine 28; CC chemokine CCL28; CCK 1; CCK1; CCK1 protein; CCL 28; CCL28; CCL28_HUMAN; Chemokine (C-C motif) ligand 28; chemokine (C-C motif) ligand 28 splice variant chi; MEC; Mucosae associated epithelial chemokine; Mucosae-associated epithelial chemokine; Protein CCK1; SCYA28; Small inducible cytokine A28 [Precursor]; small inducible cytokine subfamily A (Cys-Cys), member 28; Small-inducible cytokine A28
Function Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner.
Cellular Localization Secreted.
Protein Length Full length protein
Sequence SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKR RRICVSPHNHTVKQWMKVQAAKKNGKGNVC HRKKHHGKRNSNRAHQGKHETYGHKTPY,Belongs to the intercrine beta (chemokine CC) family.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top