Recombinant Human Ceramide synthase 1/LAG1 Protein

Recombinant Human Ceramide synthase 1/LAG1 Protein

Cat. No.: DPP-001115

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Wheat germ
Format Liquid
Purity ≥ 95% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name CERS1
UniProt No. P27544
Gene ID 10715
Alternative Names Ceramide synthase 1; CerS1; CERS1_HUMAN; LAG1; LAG1 homolog ceramide synthase 1; LAG1 longevity assurance homolog 1; LASS 1; LASS1; Longevity assurance (LAG1 S. cerevisiae) homolog 1; Longevity assurance gene 1; Longevity assurance gene 1 protein homolog 1; MGC90349; Protein LAG1; Protein UOG 1; Protein UOG-1; UOG 1 protein; UOG1; Upstream of GDF1
Function May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donor (N-linked stearoyl- (C18) ceramide) in a fumonisin B1-independent manner.
Cellular Localization Endoplasmic reticulum membrane and Endoplasmic reticulum membrane. Golgi apparatus membrane. Isoform 1 may recycle from the Golgi to the endoplasmic reticulum.
Protein Length Protein fragment
Sequence YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF,Contains 1 TLC (TRAM/LAG1/CLN8) domain.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top