Cat. No.: DPP-001064
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Wheat germ |
| Format | Liquid |
| Purity | ≥97% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | CCK |
| UniProt No. | P06307 |
| Gene ID | 885 |
| Alternative Names | (1-49)-CCK58; CCK; CCK12; CCK18; CCK25; CCK33; CCK39; CCK5; CCK58; CCK7; CCK8; CCKN_HUMAN; Cholecystokinin-5 |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion. |
| Cellular Localization | Secreted. |
| Protein Length | Full length protein |
| Sequence | MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRT DGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGW MDFGRRSAEEYEYPS,Belongs to the gastrin/cholecystokinin family. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.