Recombinant Human CPT1B Protein

Recombinant Human CPT1B Protein

Cat. No.: DPP-001250

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Wheat germ
Format Liquid
Purity ≥97% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name CPT1B
UniProt No. Q92523
Gene ID 1375
Molecular Weight 37 kDa including tags
Alternative Names Carnitine O palmitoyltransferase 1B; Carnitine O palmitoyltransferase I mitochondrial muscle isoform; Carnitine O palmitoyltransferase I muscle isoform; Carnitine O-palmitoyltransferase 1, muscle isoform; Carnitine O-palmitoyltransferase I; Carnitine palmitoyltransferase 1A (muscle); Carnitine palmitoyltransferase 1B; Carnitine palmitoyltransferase 1B (muscle); Carnitine palmitoyltransferase I like protein; Carnitine palmitoyltransferase I muscle; Carnitine palmitoyltransferase I-like protein; CPT 1B; CPT I; CPT1 M; CPT1 muscle; CPT1-M; Cpt1b; CPT1B_HUMAN; CPT1M; CPTI; CPTI M; CPTI muscle; CPTI-M; CPTIM; FLJ55729; FLJ58750; KIAA1670; M CPT1; M-CPT1; MCCPT1; MCPT1; muscle isoform
Cellular Localization Mitochondrion outer membrane.
Protein Length Protein fragment
Sequence FLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGYGV SYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS,Belongs to the carnitine/choline acetyltransferase family.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top