Cat. No.: DPP-001250
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Wheat germ |
| Format | Liquid |
| Purity | ≥97% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | CPT1B |
| UniProt No. | Q92523 |
| Gene ID | 1375 |
| Molecular Weight | 37 kDa including tags |
| Alternative Names | Carnitine O palmitoyltransferase 1B; Carnitine O palmitoyltransferase I mitochondrial muscle isoform; Carnitine O palmitoyltransferase I muscle isoform; Carnitine O-palmitoyltransferase 1, muscle isoform; Carnitine O-palmitoyltransferase I; Carnitine palmitoyltransferase 1A (muscle); Carnitine palmitoyltransferase 1B; Carnitine palmitoyltransferase 1B (muscle); Carnitine palmitoyltransferase I like protein; Carnitine palmitoyltransferase I muscle; Carnitine palmitoyltransferase I-like protein; CPT 1B; CPT I; CPT1 M; CPT1 muscle; CPT1-M; Cpt1b; CPT1B_HUMAN; CPT1M; CPTI; CPTI M; CPTI muscle; CPTI-M; CPTIM; FLJ55729; FLJ58750; KIAA1670; M CPT1; M-CPT1; MCCPT1; MCPT1; muscle isoform |
| Cellular Localization | Mitochondrion outer membrane. |
| Protein Length | Protein fragment |
| Sequence | FLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGYGV SYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS,Belongs to the carnitine/choline acetyltransferase family. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.