Recombinant Human Estrogen Receptor beta Protein

Recombinant Human Estrogen Receptor beta Protein

Cat. No.: DPP-001253

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Wheat germ
Format Liquid
Purity ≥97% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name ESR2
UniProt No. Q92731
Gene ID 2100
Molecular Weight 37 kDa including tags
Alternative Names ER BETA; ER-beta; Erb; ESR B; ESR BETA; ESR2; ESR2_HUMAN; ESRB; ESTRB; estrogen nuclear receptor beta variant a; estrogen nuclear receptor beta variant b; Estrogen receptor 2; estrogen receptor 2 (ER beta); Estrogen receptor beta; estrogen receptor beta 4; NR3A2; Nuclear receptor subfamily 3 group A member 2
Function Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. Isoform beta-cx lacks ligand binding ability and has no or only very low ere binding activity resulting in the loss of ligand-dependent transactivation ability. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.
Cellular Localization Nucleus.
Protein Length Protein fragment
Sequence ILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGR QTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNR,Belongs to the nuclear hormone receptor family. NR3 subfamily. Contains 1 nuclear receptor DNA-binding domain.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top