Recombinant Human FNDC5 Protein (Tagged) (Biotin)

Recombinant Human FNDC5 Protein (Tagged) (Biotin)

Cat. No.: DPP-001248

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System HEK 293 cells
Format Liquid
Purity ≥97% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name FNDC5
UniProt No. Q8NAU1
Gene ID 252995
Molecular Weight 16 kDa
Alternative Names Fibronectin type III domain containing 5; Fibronectin type III domain-containing protein 5; Fibronectin type III repeat containing protein 2; Fibronectin type III repeat-containing protein 2; FNDC 5; Fndc5; FNDC5_HUMAN; FRCP2; irisin
Cellular Localization Peroxisome membrane. Imported in peroxisomes through the PEX5 receptor pathway.
Protein Length Full length protein
Sequence DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQ EVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKM ASKNKDEVTMKE,Contains 1 fibronectin type-III domain.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top