Recombinant Human Galanin Protein

Recombinant Human Galanin Protein

Cat. No.: DPP-001099

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Escherichia coli
Format Liquid
Purity ≥97% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name GAL
UniProt No. P22466
Gene ID 51083
Molecular Weight 14 kDa including tags
Alternative Names GAL; GAL 1; GAL GMAP; GAL1; GALA_HUMAN; Galanin message associated peptide; Galanin message-associated peptide; Galanin precursor; Galanin prepropeptide; Galanin related peptide; Galanin/GMAP prepropeptide; GALN; GLNN; GMAP; MGC40167
Function Contracts smooth muscle of the gastrointestinal and genitourinary tract, regulates growth hormone release, modulates insulin release, and may be involved in the control of adrenal secretion.
Cellular Localization Secreted.
Protein Length Full length protein
Sequence MGSSHHHHHHSSGLVPRGSHMGSASAGLWSPAKEKRGWTLNSAGYLLGPH AVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSF LHLKEAGALDRLLDLPAAASSEDIERS,Belongs to the galanin family.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top