Recombinant Human Glucokinase Protein

Recombinant Human Glucokinase Protein

Cat. No.: DPP-001128

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Escherichia coli
Format Liquid
Purity ≥97% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name GCK
UniProt No. P35557
Gene ID 2645
Molecular Weight 53 kDa including tags
Alternative Names ATP:D-hexose 6-phosphotransferase; FGQTL3; GCK; GK; GLK; Glucokinase; Hexokinase D pancreatic isozyme; Hexokinase type IV; Hexokinase-4; Hexokinase-D; HHF3; HK IV; HK4; HKIV; HXK4_HUMAN; HXKP; LGLK; MODY2
Function Catalyzes the initial step in utilization of glucose by the beta-cell and liver at physiological glucose concentration. Glucokinase has a high Km for glucose, and so it is effective only when glucose is abundant. The role of GCK is to provide G6P for the synthesis of glycogen. Pancreatic glucokinase plays an important role in modulating insulin secretion. Hepatic glucokinase helps to facilitate the uptake and conversion of glucose by acting as an insulin-sensitive determinant of hepatic glucose usage.
Involvement In Disease Defects in GCK are the cause of maturity-onset diabetes of the young type 2 (MODY2); also shortened MODY-2. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.Defects in GCK are the cause of familial hyperinsulinemic hypoglycemia type 3 (HHF3); also known as persistent hyperinsulinemic hypoglycemia of infancy (PHHI) or congenital hyperinsulinism. HHF is the most common cause of persistent hypoglycemia in infancy. Unless early and aggressive intervention is undertaken, brain damage from recurrent episodes of hypoglycemia may occur.
Protein Length Full length protein
Sequence MLDDRARMEAAKKEKVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETH EEASVKMLPT;YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQ WSVKTKHQMYSIPEDAMTGTAE;MLFDYISECISDFLDKHQMKHKKLPL GFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN;VVGLLRDAIKRRGD FEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQN;VE LVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKL IGGKYMGE;LVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVES DTGDRKQIYNILSTLGLRPS;TTDCDIVRRACESVSTRAAHMCSAGLAG VINRMRESRSEDVMRITVGVDGSVYKLHPSFK;ERFHASVRRLTPSCEI TFIESEEGSGRGAALVSAVACKKACMLGQ,Belongs to the hexokinase family.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top