Recombinant Human Hamartin Protein

Recombinant Human Hamartin Protein

Cat. No.: DPP-001252

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Wheat germ
Format Liquid
Purity ≥97% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name TSC1
UniProt No. Q92574
Gene ID 7248
Molecular Weight 38 kDa including tags
Alternative Names Hamartin; kiaa0243; LAM; TSC; Tsc1; Tsc1 gene; TSC1_HUMAN; Tuberous sclerosis 1; Tuberous sclerosis 1 protein; tumor suppressor
Function In complex with TSC2, inhibits the nutrient-mediated or growth factor-stimulated phosphorylation of S6K1 and EIF4EBP1 by negatively regulating mTORC1 signaling. Seems not to be required for TSC2 GAP activity towards RHEB. Implicated as a tumor suppressor. Involved in microtubule-mediated protein transport, but this seems to be due to unregulated mTOR signaling.
Involvement In Disease Defects in TSC1 are the cause of tuberous sclerosis type 1 (TSC1). It is an autosomal dominant multi-system disorder that affects especially the brain, kidneys, heart, and skin. TS1C is characterized by hamartomas (benign overgrowths predominantly of a cell or tissue type that occurs normally in the organ) and hamartias (developmental abnormalities of tissue combination). Clinical symptoms can range from benign hypopigmented macules of the skin to profound mental retardation with intractable seizures to premature death from a variety of disease-associated causes.Defects in TSC1 may be a cause of focal cortical dysplasia of Taylor balloon cell type (FCDBC). FCDBC is a subtype of cortical displasias linked to chronic intractable epilepsy. Cortical dysplasias display a broad spectrum of structural changes, which appear to result from changes in proliferation, migration, differentiation, and apoptosis of neuronal precursors and neurons during cortical development.
Cellular Localization Cytoplasm. Membrane. At steady state found in association with membranes.
Protein Length Protein fragment
Sequence LKKPGHVAEVYLVHLHASVYALFHRLYGMYPCNFVSFLRSHYSMKENLET FEEVVKPMMEHVRIHPELVTGSKDHELDPRRWKRLETHDVVIECAKISLD PTEASYEDG
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top