Recombinant Human IL-15RA Protein

Recombinant Human IL-15RA Protein

Cat. No.: DPP-001198

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Wheat germ
Format Liquid
Purity ≥ 95% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name IL15RA
UniProt No. Q13261
Gene ID 3601
Molecular Weight 37 kDa including tags
Alternative Names AA690181; CD215; I15RA_HUMAN; IL 15R alpha; IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; Il15ra; Interleukin 15 receptor alpha; Interleukin 15 receptor subunit alpha; MGC104179; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA; Soluble interleukin 15 receptor subunit alpha; Soluble interleukin-15 receptor subunit alpha
Function Receptor for interleukin-15. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves STAT3, STAT5, STAT6, JAK2 (By similarity) and SYK.
Cellular Localization Secreted > extracellular space; Membrane. Nucleus membrane. Mainly found associated with the nuclear membrane and Endoplasmic reticulum membrane. Golgi apparatus membrane. Cytoplasmic vesicle membrane. Membrane. Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.
Protein Length Protein fragment
Sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKA TNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPA,Contains 1 Sushi (CCP/SCR) domain.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top