Cat. No.: DPP-001267
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Escherichia coli |
| Endotoxin Level | < 1.000 Eu/µg |
| Format | Lyophilized |
| Purity | ≥97% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | RETN |
| UniProt No. | Q9HD89 |
| Gene ID | 56729 |
| Molecular Weight | 10 kDa |
| Alternative Names | Adipose tissue specific secretory factor; Adipose tissue-specific secretory factor; ADSF; C/EBP epsilon regulated myeloid specific secreted cysteine rich protein; C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 1; C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; CG5403; Cysteine rich secreted protein A12 alpha like 2; Cysteine rich secreted protein FIZZ3; Cysteine-rich secreted protein A12-alpha-like 2; Cysteine-rich secreted protein FIZZ3; dri; FIZZ 3; FIZZ3; Found in inflammatory zone 3; HXCP 1; HXCP1; MGC126603; MGC126609; PRO1199; Resistin; Resistin delta2; RETN; RETN 1; RETN_HUMAN; RETN1; RSTN; UNQ407; XCP 1; XCP1 |
| Function | Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes. |
| Cellular Localization | Secreted. |
| Protein Length | Protein fragment |
| Sequence | MSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPR GFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP,Belongs to the resistin/FIZZ family. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.