Recombinant Human Resistin Protein (Active)

Recombinant Human Resistin Protein (Active)

Cat. No.: DPP-001267

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Escherichia coli
Endotoxin Level < 1.000 Eu/µg
Format Lyophilized
Purity ≥97% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name RETN
UniProt No. Q9HD89
Gene ID 56729
Molecular Weight 10 kDa
Alternative Names Adipose tissue specific secretory factor; Adipose tissue-specific secretory factor; ADSF; C/EBP epsilon regulated myeloid specific secreted cysteine rich protein; C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 1; C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; CG5403; Cysteine rich secreted protein A12 alpha like 2; Cysteine rich secreted protein FIZZ3; Cysteine-rich secreted protein A12-alpha-like 2; Cysteine-rich secreted protein FIZZ3; dri; FIZZ 3; FIZZ3; Found in inflammatory zone 3; HXCP 1; HXCP1; MGC126603; MGC126609; PRO1199; Resistin; Resistin delta2; RETN; RETN 1; RETN_HUMAN; RETN1; RSTN; UNQ407; XCP 1; XCP1
Function Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.
Cellular Localization Secreted.
Protein Length Protein fragment
Sequence MSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPR GFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP,Belongs to the resistin/FIZZ family.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top