Recombinant Human UCP1 Protein

Recombinant Human UCP1 Protein

Cat. No.: DPP-001108

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Wheat germ
Format Liquid
Purity ≥ 70% by HPLC
Nature Recombinant
Target Information
Gene Name UCP1
UniProt No. P25874
Gene ID 7350
Molecular Weight 30 kDa including tags
Alternative Names mitochondrial brown fat uncoupling protein; Mitochondrial brown fat uncoupling protein 1; SLC25A7; Solute carrier family 25 member 7; Thermogenin; UCP; UCP 1; UCP1; UCP1_HUMAN; Uncoupling protein 1; uncoupling protein 1 (mitochondrial, proton carrier)
Function UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.
Cellular Localization Mitochondrion inner membrane.
Protein Length Protein fragment
Sequence PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF,Belongs to the mitochondrial carrier family. Contains 3 Solcar repeats.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top