Cat. No.: DPP-001172
| Product Overview | |
|---|---|
| Species | Human |
| Expression System | Escherichia coli |
| Format | Lyophilized |
| Purity | ≥97% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | UCP3 |
| UniProt No. | P55916 |
| Gene ID | 7352 |
| Alternative Names | Mitochondrial uncoupling protein 3; SLC25A9; Solute carrier family 25 member 9; UCP 3; UCP3; UCP3_HUMAN; Uncoupling protein 3; Uncoupling protein 3 mitochondrial proton carrier |
| Function | UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. As a result, energy is dissipated in the form of heat. May play a role in the modulation of tissue respiratory control. Participates in thermogenesis and energy balance. |
| Involvement In Disease | Defects in UCP3 may be involved in obesity (OBESITY). It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat. |
| Cellular Localization | Mitochondrion inner membrane. |
| Protein Length | Protein fragment |
| Sequence | GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLT,Belongs to the mitochondrial carrier family. Contains 3 Solcar repeats. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.