Recombinant Human UCP3 Protein

Recombinant Human UCP3 Protein

Cat. No.: DPP-001172

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Escherichia coli
Format Lyophilized
Purity ≥97% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name UCP3
UniProt No. P55916
Gene ID 7352
Alternative Names Mitochondrial uncoupling protein 3; SLC25A9; Solute carrier family 25 member 9; UCP 3; UCP3; UCP3_HUMAN; Uncoupling protein 3; Uncoupling protein 3 mitochondrial proton carrier
Function UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. As a result, energy is dissipated in the form of heat. May play a role in the modulation of tissue respiratory control. Participates in thermogenesis and energy balance.
Involvement In Disease Defects in UCP3 may be involved in obesity (OBESITY). It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.
Cellular Localization Mitochondrion inner membrane.
Protein Length Protein fragment
Sequence GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLT,Belongs to the mitochondrial carrier family. Contains 3 Solcar repeats.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top