Recombinant mouse IL-15 Protein (Active)

Recombinant mouse IL-15 Protein (Active)

Cat. No.: DPP-001159

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Mouse
Expression System Escherichia coli
Endotoxin Level < 1.000 Eu/µg
Format Liquid
Purity ≥97% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name Il15
UniProt No. P48346
Gene ID 16168
Molecular Weight 18 kDa including tags
Alternative Names IL 15; IL-15; IL15; IL15_HUMAN; Interleukin 15; Interleukin-15; Interleukin15; MGC9721
Function Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
Cellular Localization Secreted and Cytoplasm. Nucleus. IL15-S21AA is not secreted, but rather is stored intracellularly, appearing in the nucleus and cytoplasmic components.
Protein Length Full length protein
Sequence MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMNWIDVRYDLEKI ESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNET VRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFIN TS,Belongs to the IL-15/IL-21 family.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top