Cat. No.: DPP-001032
| Product Overview | |
|---|---|
| Species | Mouse |
| Expression System | Baculovirus infected insect cells |
| Endotoxin Level | < 1.000 Eu/µg |
| Format | Liquid |
| Purity | ≥95% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | Tnfrsf11b |
| UniProt No. | O08712 |
| Gene ID | 18383 |
| Molecular Weight | 44 kDa including tags |
| Alternative Names | MGC29565; OCIF; OPG; Osteoclastogenesis inhibitory factor; Osteoprotegerin; PDB5; TNF receptor superfamily member 11b; TNFRSF 11B; TNFRSF11B; TR 1; TR1; TR11B_HUMAN; Tumor necrosis factor receptor superfamily member 11B |
| Function | Acts as decoy receptor for RANKL and thereby neutralizes its function in osteoclastogenesis. Inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local RANKL/OPG ratio. May also play a role in preventing arterial calcification. May act as decoy receptor for TRAIL and protect against apoptosis. TRAIL binding blocks the inhibition of osteoclastogenesis. |
| Involvement In Disease | Defects in TNFRSF11B are the cause of juvenile Paget disease (JPD); also known as hyperostosis corticalis deformans juvenilis or hereditary hyperphosphatasia or chronic congenital idiopathic hyperphosphatasia. JPD is a rare autosomal recessive osteopathy that presents in infancy or early childhood. The disorder is characterized by rapidly remodeling woven bone, osteopenia, debilitating fractures, and deformities due to a markedly accelerated rate of bone remodeling throughout the skeleton. Approximately 40 cases of JPD have been reported worldwide. Unless it is treated with drugs that block osteoclast-mediated skeletal resorption, the disease can be fatal. |
| Cellular Localization | Secreted. |
| Protein Length | Full length protein |
| Sequence | ETLPPKYLHYDPETGHQLLCDKCAPGTYLKQHCTVRRKTLCVPCPDHSYT DSWHTSDECVYCSPVCKELQSVKQECNRTHNRVCECEEGRYLEIEFCLKH RSCPPGSGVVQAGTPERNTVCKKCPDGFFSGETSSKAPCIKHTNCSTFGL LLIQKGNATHDNVCSGNREATQKCGIDVTLCEEAFFRFAVPTKIIPNWLS VLVDSLPGTKVNAESVERIKRRHSSQEQTFQLLKLWKHQNRDQEMVKKII QDIDLCESSVQRHLGHSNLTTEQLLALMESLPGKKISPEEIERTRKTCKS SEQLLKLLSLWRIKNGDQDTLKGLMYALKHLKTSHFPKTVTHSLRKTMRF LHSFTMYRLYQKLFLEMIGNQVQSVKISCLLEHHHHHH,Contains 2 death domains. Contains 4 TNFR-Cys repeats. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.