Recombinant Mouse REG1 Protein (His tag)

Recombinant Mouse REG1 Protein (His tag)

Cat. No.: DPP-001154

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Mouse
Expression System Escherichia coli
Format Liquid
Purity ≥97% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name Reg1
UniProt No. P43137
Gene ID 19692
Molecular Weight 32 kDa including tags
Alternative Names ICRF; Islet cells regeneration factor; Islet of Langerhans regenerating protein; Lithostathine 1 beta; Lithostathine-1-alpha; P19; Pancreatic stone protein; Pancreatic stone protein 2; Pancreatic thread protein; PSP; PSPS; PSPS1; PSPS2; PTP; REG; REG 1 beta; REG-1-alpha; REG1A; REG1A_HUMAN; REG1B; Regenerating islet derived protein 1 beta; Regenerating islet-derived protein 1-alpha; Regenerating protein I alpha; REGL
Function Might act as an inhibitor of spontaneous calcium carbonate precipitation. May be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.
Cellular Localization Secreted.
Protein Length Full length protein
Sequence QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYL VSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYK SWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG,Contains 1 C-type lectin domain.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top