Recombinant Rat Leptin Protein (Active)

Recombinant Rat Leptin Protein (Active)

Cat. No.: DPP-001168

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Rat
Expression System Escherichia coli
Endotoxin Level < 1.000 Eu/µg
Format Lyophilized
Purity ≥ 85% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name Lep
UniProt No. P50596
Gene ID 25608
Molecular Weight 16 kDa
Alternative Names FLJ94114; LEP; LEP_HUMAN; LEPD; Leptin; Leptin (murine obesity homolog); Leptin (obesity homolog, mouse); Leptin Murine Obesity Homolog; Leptin Precursor Obesity Factor; OB; Obese protein; Obese, mouse, homolog of; Obesity; Obesity factor; Obesity homolog mouse; Obesity Murine Homolog Leptin; OBS; OTTHUMP00000212285
Function May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Involvement In Disease Defects in LEP may be a cause of obesity (OBESITY). It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.
Cellular Localization Secreted.
Protein Length Full length protein
Sequence MVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPIL SLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLP QTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC,Belongs to the leptin family.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top